PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g112760.1
Common NameMTR_1g112760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 231aa    MW: 26476.2 Da    PI: 8.6191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g112760.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++++++G g+W+++++  g+ R++k+c++rw +yl
  Medtr1g112760.1 15 KGLWSPEEDDKLFNYITMFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding47.64e-1568111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k++w++
  Medtr1g112760.1  68 RGMFSKQEEDLIINLHEALGNR-WAQIASQLP-GRTDNEIKNFWNS 111
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-24765IPR009057Homeodomain-like
PROSITE profilePS5129423.8941066IPR017930Myb domain
SuperFamilySSF466893.74E-2913109IPR009057Homeodomain-like
SMARTSM007178.4E-121464IPR001005SANT/Myb domain
PfamPF002492.4E-141562IPR001005SANT/Myb domain
CDDcd001675.24E-101862No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2566117IPR009057Homeodomain-like
PROSITE profilePS5129418.78367117IPR017930Myb domain
SMARTSM007172.6E-1467115IPR001005SANT/Myb domain
PfamPF002493.9E-1468111IPR001005SANT/Myb domain
CDDcd001672.60E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRRHSCSLK QKLRKGLWSP EEDDKLFNYI TMFGVGCWSS VPKLAGLQRC GKSCRLRWIN  60
YLRPDLKRGM FSKQEEDLII NLHEALGNRW AQIASQLPGR TDNEIKNFWN SSLKKKLMKQ  120
GIDPATHKPL INNESLLVKE EKEKPSMIMP LSQPQPQRTL MLESSHEYSE ALLMNKPTFD  180
LDPLQLQFEL NQFGTNSSYF FSSDNISNNS FSNMINENTA GGLISWEGEN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
1h8a_C1e-28911721128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.157611e-110leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0529241e-108BT052924.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-C-4 unknown mRNA.
GenBankBT1342151e-108BT134215.1 Medicago truncatula clone JCVI-FLMt-12F11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013470336.11e-171myb transcription factor
SwissprotQ8LPH62e-79MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A072VQY31e-171A0A072VQY3_MEDTR; Myb transcription factor
STRINGGLYMA04G36110.19e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.17e-80myb domain protein 86
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]